Pteropus vampyrus (large flying fox): 105308560 Help Entry 105308560         CDS       T07815                                  Symbol DYNLT3 Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism pvp  Pteropus vampyrus (large flying fox) Pathway pvp04814   Motor proteins pvp05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pvp00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     105308560 (DYNLT3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105308560 (DYNLT3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pvp03037]     105308560 (DYNLT3)    04812 Cytoskeleton proteins [BR:pvp04812]     105308560 (DYNLT3) Cilium and associated proteins [BR:pvp03037]  Motile cilia and associated proteins   Dynein arm    105308560 (DYNLT3) Cytoskeleton proteins [BR:pvp04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      105308560 (DYNLT3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  105308560 NCBI-ProteinID:  XP_011382862 UniProt:  A0A6P3S067 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MEEYHRHCDEVGFNAEEAHNIVKECIDGVLGGEDYNQNNINQWTASIVEQSLAHLVKLGK AYKYIVTCAVVQRSAYGFHTASSCFWDVTSDGTCTVRWENRTMNCIVNVFAIAIVL NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggaggagtatcatcgccactgcgacgaggttggcttcaatgcggaggaagcccacaat attgttaaagagtgtatagatggagttttgggtggtgaagattataatcagaacaacatc aaccaatggaccgcaagcatagtggaacaatccttagcacatttggttaagctgggaaaa gcttataaatatattgtgacctgtgcagtggtccagaggagtgcatacggctttcataca gccagctcatgcttttgggatgtcacatctgatggaacctgtaccgtaagatgggagaac cgaaccatgaattgtatcgtcaatgtttttgccattgcaattgtcctgtga

DBGET integrated database retrieval system