Pteropus vampyrus (large flying fox): 105309143 Help Entry 105309143         CDS       T07815                                  Name (RefSeq) interferon alpha-4-like   KO K05414   interferon alpha Organism pvp  Pteropus vampyrus (large flying fox) Pathway pvp04060   Cytokine-cytokine receptor interaction pvp04151   PI3K-Akt signaling pathway pvp04217   Necroptosis pvp04620   Toll-like receptor signaling pathway pvp04621   NOD-like receptor signaling pathway pvp04622   RIG-I-like receptor signaling pathway pvp04623   Cytosolic DNA-sensing pathway pvp04630   JAK-STAT signaling pathway pvp04650   Natural killer cell mediated cytotoxicity pvp04936   Alcoholic liver disease pvp05152   Tuberculosis pvp05160   Hepatitis C pvp05161   Hepatitis B pvp05162   Measles pvp05163   Human cytomegalovirus infection pvp05164   Influenza A pvp05165   Human papillomavirus infection pvp05167   Kaposi sarcoma-associated herpesvirus infection pvp05168   Herpes simplex virus 1 infection pvp05169   Epstein-Barr virus infection pvp05170   Human immunodeficiency virus 1 infection pvp05171   Coronavirus disease - COVID-19 pvp05200   Pathways in cancer pvp05320   Autoimmune thyroid disease pvp05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pvp00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     105309143    04151 PI3K-Akt signaling pathway     105309143   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105309143  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     105309143  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105309143    04621 NOD-like receptor signaling pathway     105309143    04622 RIG-I-like receptor signaling pathway     105309143    04623 Cytosolic DNA-sensing pathway     105309143    04650 Natural killer cell mediated cytotoxicity     105309143  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105309143   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     105309143    05161 Hepatitis B     105309143    05160 Hepatitis C     105309143    05171 Coronavirus disease - COVID-19     105309143    05164 Influenza A     105309143    05162 Measles     105309143    05168 Herpes simplex virus 1 infection     105309143    05163 Human cytomegalovirus infection     105309143    05167 Kaposi sarcoma-associated herpesvirus infection     105309143    05169 Epstein-Barr virus infection     105309143    05165 Human papillomavirus infection     105309143   09171 Infectious disease: bacterial    05152 Tuberculosis     105309143   09163 Immune disease    05320 Autoimmune thyroid disease     105309143   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105309143   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     105309143  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pvp04052]     105309143 Cytokines and neuropeptides [BR:pvp04052]  Cytokines   Interferons    105309143 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  105309143 NCBI-ProteinID:  XP_011383539 UniProt:  A0A6P3RLG2 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MALPFSFLVAVGVLSCHSICSLGCDLLQTHSLVNRRALMLLGQMRRISPFSCLKDREDFG FLQGAFGGNQFQEAQAITVIHEVTWQTFLLFCTEASSTAWDETLLGRFCTGLYQQLNHLE ACQTQELGTEETSLLDEDSTLAVRKYFQRITLYLQEKKHSPCAWEIVRAEIMRSYSLSTH LKERSRSKD NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggctctgcctttttccttcctggtggctgtgggggtgctcagctgccactccatctgc tctctgggctgtgacctgcttcagacccacagcctggtcaacaggagggcgttgatgctc ctgggacaaatgaggagaatctcccctttctcctgcctcaaggatagagaagattttgga ttcctccagggggcgtttggtggcaaccagttccaggaggctcaagccatcactgtcatc catgaggtgacctggcagaccttcctcctcttctgcacagaggcttcgtccacagcttgg gatgagaccctgttaggcagattctgcactggactctatcagcagctgaaccacctggaa gcctgtcagacgcaggagctggggacggaggagacttccctgctggatgaggactccaca ctggctgtgaggaaatacttccagagaatcaccctctatctgcaggagaagaaacacagc ccttgtgcctgggagattgtcagagcagagatcatgaggtcctactctttatcaacacac ttgaaggaaagatcaaggagtaaggattaa

DBGET integrated database retrieval system