Pteropus vampyrus (large flying fox): 105309567 Help Entry 105309567         CDS       T07815                                  Symbol ARF6 Name (RefSeq) ADP-ribosylation factor 6   KO K07941   ADP-ribosylation factor 6 Organism pvp  Pteropus vampyrus (large flying fox) Pathway pvp04014   Ras signaling pathway pvp04072   Phospholipase D signaling pathway pvp04144   Endocytosis pvp04517   IgSF CAM signaling pvp04666   Fc gamma R-mediated phagosome formation pvp05132   Salmonella infection pvp05135   Yersinia infection Brite KEGG Orthology (KO) [BR:pvp00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     105309567 (ARF6)    04072 Phospholipase D signaling pathway     105309567 (ARF6)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     105309567 (ARF6)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     105309567 (ARF6)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagosome formation     105309567 (ARF6)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105309567 (ARF6)    05135 Yersinia infection     105309567 (ARF6)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pvp04131]     105309567 (ARF6)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pvp04147]     105309567 (ARF6)    04031 GTP-binding proteins [BR:pvp04031]     105309567 (ARF6) Membrane trafficking [BR:pvp04131]  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     105309567 (ARF6)   Arf GTPases and associated proteins    Arf GTPases     105309567 (ARF6) Exosome [BR:pvp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105309567 (ARF6)   Exosomal proteins of colorectal cancer cells    105309567 (ARF6) GTP-binding proteins [BR:pvp04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     105309567 (ARF6) SSDB OrthologParalogGFIT Motif Pfam:  Arf Roc G-alpha Ras SRPRB Gtr1_RagA MMR_HSR1 GTP_EFTU 6PF2K SpoOE-like CRISPR_Cas2 Motif Other DBs NCBI-GeneID:  105309567 NCBI-ProteinID:  XP_011384059 UniProt:  A0A6P3RN35 LinkDB All DBs Position Unknown AA seq 175 aa AA seqDB search MGKVLSKIFGNKEMRILMLGLDAAGKTTVLYKLKLGQSVTTIPTVGFNVETVTYKNVKFN VWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIF ANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS NT seq 528 nt NT seq  +upstreamnt  +downstreamnt atggggaaggtgctatccaagatcttcgggaacaaggaaatgcggatcctcatgttgggc ctggacgcggccggcaagacaacagtcctgtacaagttgaagctgggccagtcagtgacc accatccccaccgtaggtttcaacgtggagacggtgacttacaaaaacgtcaagttcaac gtgtgggatgtgggcggccaggacaagatccggccgctctggcggcattactacaccggg acccagggtctgatcttcgtggtggactgcgccgaccgcgaccgcatcgacgaggcccgc caggagctgcaccgcattatcaatgaccgggagatgagggacgccataatcctcatcttc gccaacaagcaggacctgcctgatgccatgaaaccccatgagatccaggagaaactgggc ctgacccggattcgggacaggaactggtatgtgcagccttcttgtgccacctcaggggac ggactctatgaggggctcacatggttaacctctaactacaaatcctaa

DBGET integrated database retrieval system