Pteropus vampyrus (large flying fox): 105309974 Help Entry 105309974         CDS       T07815                                  Name (RefSeq) histone H2B type 2-F   KO K11252   histone H2B Organism pvp  Pteropus vampyrus (large flying fox) Pathway pvp04613   Neutrophil extracellular trap formation pvp05034   Alcoholism pvp05203   Viral carcinogenesis pvp05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pvp00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105309974  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     105309974   09163 Immune disease    05322 Systemic lupus erythematosus     105309974   09165 Substance dependence    05034 Alcoholism     105309974  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pvp03036]     105309974   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pvp04147]     105309974 Chromosome and associated proteins [BR:pvp03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105309974 Exosome [BR:pvp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105309974 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like DUF6246 Motif Other DBs NCBI-GeneID:  105309974 NCBI-ProteinID:  XP_011384481 UniProt:  A0A6P3S3C6 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgccagatccagcaaaatctgctccggctcccaagaagggctccaagaaagctgttacg aaagtgcagaagaaggatgggaagaagcgtaagcgcagccggaaggagagttattccgtt tatgtgtacaaagtcctgaagcaggttcatcctgacaccggtatctcgtccaaggccatg ggcatcatgaattctttcgtcaacgacatcttcgagcgcatcgccggcgaggcctcccgt ctggcgcattacaacaagcgttcgaccatcacgtcccgggagatccagacggccgtgcgc ctgctgcttcctggtgagctggccaagcacgccgtgtccgagggcaccaaggccgtgacc aagtacaccagctccaagtaa

DBGET integrated database retrieval system