Pteropus vampyrus (large flying fox): 105309975 Help Entry 105309975         CDS       T07815                                  Name (RefSeq) histone H2A type 2-A isoform X2   KO K11251   histone H2A Organism pvp  Pteropus vampyrus (large flying fox) Pathway pvp03082   ATP-dependent chromatin remodeling pvp04217   Necroptosis pvp04613   Neutrophil extracellular trap formation pvp05034   Alcoholism pvp05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pvp00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     105309975  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     105309975  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105309975  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     105309975   09165 Substance dependence    05034 Alcoholism     105309975  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pvp03036]     105309975   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pvp04147]     105309975 Chromosome and associated proteins [BR:pvp03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105309975 Exosome [BR:pvp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105309975 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Histone_ABTB Clp_N Motif Other DBs NCBI-GeneID:  105309975 NCBI-ProteinID:  XP_011384482 UniProt:  A0A6P3RXA9 LinkDB All DBs Position Unknown AA seq 130 aa AA seqDB search MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TESHHKAKGK NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgtctggccgtggcaagcagggaggcaaggcccgcgctaaggccaagtcgcggtcttcc cgcgctgggcttcagttccccgtgggccgagtgcaccgcctgctgcgcaaaggcaactac gccgagcgggtgggggccggcgcgcccgtctacatggcggccgtgctcgagtacctgacg gcggagatcctggagctggcgggcaacgccgcccgagacaacaagaagacgcgcatcatc cctcgtcacctgcagctggccatccgcaacgacgaggagctgaacaagctgctgggcaaa gtcaccatcgcccagggcggtgttttgcccaacatccaggccgtgttgctccctaagaag acggagagtcaccacaaggccaagggcaagtga

DBGET integrated database retrieval system