Pteropus vampyrus (large flying fox): 105311492 Help Entry 105311492         CDS       T07815                                  Name (RefSeq) histone H2B-like   KO K11252   histone H2B Organism pvp  Pteropus vampyrus (large flying fox) Pathway pvp04613   Neutrophil extracellular trap formation pvp05034   Alcoholism pvp05203   Viral carcinogenesis pvp05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pvp00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105311492  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     105311492   09163 Immune disease    05322 Systemic lupus erythematosus     105311492   09165 Substance dependence    05034 Alcoholism     105311492  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pvp03036]     105311492   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pvp04147]     105311492 Chromosome and associated proteins [BR:pvp03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105311492 Exosome [BR:pvp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105311492 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TAF Motif Other DBs NCBI-GeneID:  105311492 NCBI-ProteinID:  XP_011385783 UniProt:  A0A6P3S0L5 LinkDB All DBs Position Unknown AA seq 147 aa AA seqDB search MPAPASEASEGLLGTQKPTEAPPKAPDQKTPRRPRRRCSDTFTTYFPRVLKNVHQGPSLS REAVSVMDSFVEDIFQRIAEEASRLALSNQRATMTSRDIQTAVRLPLPGEMGKHALSEAT KAVLRSSLCLIRQQIKCRSSYKNPSVF NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atgcctgcgcctgcctctgaggcttctgagggattgctgggcacgcagaagcccacggaa gcacccccgaaggcccctgaccagaagacgccaaggcgcccgcgccgccgctgctccgac actttcaccacctatttcccccgggttctgaagaacgttcaccagggcccgagcctgtcg cgggaggccgtgagcgtcatggattcgttcgtggaggacatcttccagcgcatcgccgaa gaggcctcgcgcctggccctctccaaccagcgcgccaccatgacctccagagacatccag acggccgtgaggctgcccctgcccggggagatgggcaagcacgccttgtccgaggccacc aaggccgtcctccgaagttcattatgtctgatacgacaacagataaagtgcagaagcagt tacaagaatccatccgtcttctga

DBGET integrated database retrieval system