Pteropus vampyrus (large flying fox): 111728731 Help Entry 111728731         CDS       T07815                                  Symbol ELOC Name (RefSeq) elongin-C   KO K03872   elongin-C Organism pvp  Pteropus vampyrus (large flying fox) Pathway pvp04066   HIF-1 signaling pathway pvp04120   Ubiquitin mediated proteolysis pvp05170   Human immunodeficiency virus 1 infection pvp05200   Pathways in cancer pvp05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:pvp00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     111728731 (ELOC)  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     111728731 (ELOC)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     111728731 (ELOC)   09162 Cancer: specific types    05211 Renal cell carcinoma     111728731 (ELOC)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     111728731 (ELOC)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pvp04121]     111728731 (ELOC)    03400 DNA repair and recombination proteins [BR:pvp03400]     111728731 (ELOC) Ubiquitin system [BR:pvp04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      111728731 (ELOC)    Cul5 complex      111728731 (ELOC) DNA repair and recombination proteins [BR:pvp03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      111728731 (ELOC) SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  111728731 NCBI-ProteinID:  XP_011365243 UniProt:  A0A6P3QSA2 LinkDB All DBs Position Unknown AA seq 96 aa AA seqDB search MYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMY FTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgtatgttaaattgatatcttcggatggtcatgaattcattgtaaaaagagaacatgcg ttaacatcaggaacaataaaagccatgttgagtggcccaggtcagtttgctgagaacgaa actaatgaagtcaattttagagagatcccttcacatgtgctatcaaaagtatgcatgtat tttacttacaaggttcgctacactaacagctccacggagattcctgaattccccattgca cctgaaattgcactggaactgctgatggctgcgaacttcctagattgttaa

DBGET integrated database retrieval system