Pseudomonas veronii: PverR02_01735 Help Entry PverR02_01735     CDS       T04853                                  Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism pvr  Pseudomonas veronii Brite KEGG Orthology (KO) [BR:pvr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:pvr03110]     PverR02_01735 Chaperones and folding catalysts [BR:pvr03110]  Protein folding catalysts   Protein disulfide isomerase    PverR02_01735 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Thioredoxin_2 GST_N Glrx-like DSBA Thioredoxin CLIC-like_N SH3BGR Motif Other DBs NCBI-ProteinID:  AQY63812 UniProt:  A0A0R3BFY0 LinkDB All DBs Position 397594..397848 Genome browser AA seq 84 aa AA seqDB search MSQVVVYSSDWCPYCMRAKALLEKKGVAFEEIKVDGKPQVRAEMAQKAGRTSVPQIWIGA KHVGGCDDLFALERAGKLDALLHV NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgagccaggttgtcgtgtattccagcgattggtgcccttactgcatgcgggccaaggcc ttgctggagaagaagggggttgccttcgaagagatcaaggtcgatggcaaaccccaggtg cgcgccgaaatggcccagaaggcgggacgcacgtccgtgccgcagatctggatcggcgcc aagcacgtcggtggatgcgatgacctgtttgcccttgagcgcgccggcaagctggacgcg ctgcttcacgtctga

DBGET integrated database retrieval system