Pseudomonas veronii: PverR02_02255 Help Entry PverR02_02255     CDS       T04853                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pvr  Pseudomonas veronii Pathway pvr01100   Metabolic pathways pvr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pvr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PverR02_02255    00074 Mycolic acid biosynthesis     PverR02_02255   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PverR02_02255 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AQY63908 UniProt:  A0A0R3BDC5 LinkDB All DBs Position complement(514553..514822) Genome browser AA seq 89 aa AA seqDB search MSNSNSLEHDIKTLIIEALGLEDISVDDINSDQTLFGEGLGLDSVDALELGLAIQKKYGF KIDADAKDTRNHFTNVASLAAFVTAKQAA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgagcaactcaaacagccttgagcacgacataaagacgctgatcatcgaggccctgggc ctggaagacatcagcgtcgacgacatcaacagcgaccaaaccctgttcggcgaaggcctc ggcctggactcagtcgacgccctggaactgggcctggcgatccagaaaaagtacggcttc aagatcgatgccgacgccaaggacacccgcaatcacttcaccaacgtggccagccttgcg gcgttcgtcacggccaaacaggcagcttga

DBGET integrated database retrieval system