Pseudomonas veronii: PverR02_14700 Help Entry PverR02_14700     CDS       T04853                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism pvr  Pseudomonas veronii Pathway pvr00362   Benzoate degradation pvr00621   Dioxin degradation pvr00622   Xylene degradation pvr01100   Metabolic pathways pvr01120   Microbial metabolism in diverse environments pvr01220   Degradation of aromatic compounds Module pvr_M00569   Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA Brite KEGG Orthology (KO) [BR:pvr00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     PverR02_14700    00622 Xylene degradation     PverR02_14700    00621 Dioxin degradation     PverR02_14700 Enzymes [BR:pvr01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      PverR02_14700 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 Tautomerase_3 Motif Other DBs NCBI-ProteinID:  AQY66242 UniProt:  A0A4P7YAG9 LinkDB All DBs Position 3237164..3237376 Genome browser AA seq 70 aa AA seqDB search MPIIEMHLAEGRTAEQKSRMAVAVTEAVCLSLQCPAETVRILITEHARDGFYVAGLDMAQ RAAKQREQGQ NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgcccattattgaaatgcatttggccgagggccgtactgccgagcaaaagagccgtatg gctgtcgcggtcactgaagcggtgtgcctcagcctgcaatgccccgcggaaaccgtaaga attctgatcaccgagcacgcgcgcgacgggttttacgtggccggcctggacatggcccag cgcgccgccaagcagcgggagcagggccaatga

DBGET integrated database retrieval system