Candidatus Planktophila versatilis: A1sIA79_04250 Help Entry A1sIA79_04250     CDS       T05250                                  Name (GenBank) mycoredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism pvs  Candidatus Planktophila versatilis Brite KEGG Orthology (KO) [BR:pvs00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     A1sIA79_04250 Enzymes [BR:pvs01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      A1sIA79_04250 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 Thioredoxin_9 Thioredoxin Thioredoxin_2 GST_N_2 Glrx-like HetR_C DUF3088 Motif Other DBs NCBI-ProteinID:  ASY17429 LinkDB All DBs Position complement(836574..836831) Genome browser AA seq 85 aa AA seqDB search MALVDITMYGADWCGDCRRSKRLLEELDVQVNHIDVEVDESAAAKVREINGGAQSIPVLV FSDGTHMTEPSDNDLKAKLTSLGII NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggcacttgtagatatcacgatgtatggagccgactggtgtggagattgccgtcgttcc aagcgacttttagaagagctcgatgttcaggtcaaccatattgatgttgaagtagatgag tctgcagcagcaaaggtccgtgagatcaacgggggagcgcagtcaattccagtgcttgtt ttttcagatggcacacatatgacagagccatcagataatgatttgaaggcaaagctaact tcgctgggaattatctag

DBGET integrated database retrieval system