Phaseolus vulgaris (common bean): 137810939 Help Entry 137810939         CDS       T03093                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism pvu  Phaseolus vulgaris (common bean) Pathway pvu03083   Polycomb repressive complex pvu04120   Ubiquitin mediated proteolysis pvu04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:pvu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     137810939    04120 Ubiquitin mediated proteolysis     137810939   09126 Chromosome    03083 Polycomb repressive complex     137810939  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pvu04131]     137810939    04121 Ubiquitin system [BR:pvu04121]     137810939    03036 Chromosome and associated proteins [BR:pvu03036]     137810939 Membrane trafficking [BR:pvu04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     137810939 Ubiquitin system [BR:pvu04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      137810939    Cul7 complex      137810939 Chromosome and associated proteins [BR:pvu03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      137810939   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      137810939 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  137810939 NCBI-ProteinID:  XP_068468544 LinkDB All DBs Position 2:complement(22541223..22544004) Genome browser AA seq 155 aa AA seqDB search MSSARKITLKSSDGEAFEVDEAVALESQTIKHMIEDDCADSGIPLPNVTSKILAKVIEYC KKHVDAANPDDKPSEEDLKAWDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI KGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgtcatcggcgaggaagatcaccctgaagagttcggacggggaggcgttcgaggtggac gaggcggtggcgttggagtcgcagacgataaagcatatgattgaggacgactgcgccgac agcggcatccctctccccaacgtcaccagcaagatcctcgccaaagttatcgagtactgc aaaaaacacgtcgacgccgccaatcccgacgacaaaccctctgaggaagatctcaaggcc tgggacgcggatttcgtcaaggtcgatcaggccacgctctttgatctcatcctggctgcg aactacctgaacatcaagagcctgctggatcttacatgccagactgtagcagacatgatc aaggggaagactccagaggaaattcgcaagacctttaacattaagaatgacttcacccct gaggaagaagaggaagttcgtcgggaaaatcaatgggcctttgaatga

DBGET integrated database retrieval system