Phaseolus vulgaris (common bean): 137811776 Help Entry 137811776         CDS       T03093                                  Name (RefSeq) uncharacterized protein   KO K03505   DNA polymerase delta subunit 4 Organism pvu  Phaseolus vulgaris (common bean) Pathway pvu03030   DNA replication pvu03410   Base excision repair pvu03420   Nucleotide excision repair pvu03430   Mismatch repair pvu03440   Homologous recombination Brite KEGG Orthology (KO) [BR:pvu00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     137811776    03410 Base excision repair     137811776    03420 Nucleotide excision repair     137811776    03430 Mismatch repair     137811776    03440 Homologous recombination     137811776  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pvu03032]     137811776    03400 DNA repair and recombination proteins [BR:pvu03400]     137811776 DNA replication proteins [BR:pvu03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     137811776 DNA repair and recombination proteins [BR:pvu03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       137811776    MMR (mismatch excision repair)     DNA polymerase delta complex      137811776 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  137811776 NCBI-ProteinID:  XP_068469710 LinkDB All DBs Position 2:complement(36702629..36703424) Genome browser AA seq 118 aa AA seqDB search MATVSGNMKGFYRQRKTTATKKSSKKSPINAAILGSTSVQTLATISPGGKPDLQYECSES EVVLRQFDLNMAYGPCLGMARLARWERAQRLGLNPPLEIESLLKSGKVQMESLWGGRI NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggcgaccgtgtctggaaatatgaagggtttttaccgacagaggaaaaccaccgccacg aagaaatcttccaaaaaatctccgattaacgccgccattttgggatccacttcggtccaa acactggccaccatctcccccggcggaaaaccggacctccaatatgaatgcagtgagagc gaggtggtgttgcggcaattcgatttgaacatggcgtatgggccctgccttgggatggcg cggcttgcacggtgggagcgtgctcagaggcttggtttgaaccctccgctggaaatcgag agtctcttgaagagtgggaaagttcagatggagtccttgtggggtggtcgcatttaa

DBGET integrated database retrieval system