Phaseolus vulgaris (common bean): 137814192 Help Entry 137814192         CDS       T03093                                  Name (RefSeq) sm-like protein LSM2   KO K12621   U6 snRNA-associated Sm-like protein LSm2 Organism pvu  Phaseolus vulgaris (common bean) Pathway pvu03018   RNA degradation pvu03040   Spliceosome Brite KEGG Orthology (KO) [BR:pvu00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     137814192   09123 Folding, sorting and degradation    03018 RNA degradation     137814192  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pvu03019]     137814192    03041 Spliceosome [BR:pvu03041]     137814192 Messenger RNA biogenesis [BR:pvu03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      137814192   mRNA degradation factors    5'-3' decay     Lsm complex      137814192 Spliceosome [BR:pvu03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     137814192  Complex C   U2 snRNP components     137814192 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM SM-ATX DUF150_C DUF1256 Motif Other DBs NCBI-GeneID:  137814192 NCBI-ProteinID:  XP_068472884 LinkDB All DBs Position 1:39543332..39545920 Genome browser AA seq 93 aa AA seqDB search MLFFSYFKDLVGREVTVELKNDLAIRGTLHSVDQYLNIKLENTRVVDQDKYPHMLSVRNC FIRGSVVRYVQLPPEGVDIELLHDATRREARGG NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgttgttcttctcgtacttcaaggatttggtgggaagagaagtaaccgtggagctgaag aacgatttggccatcagagggacattgcattccgttgatcagtacctcaacataaagctc gaaaacactcgcgtcgtcgatcaagacaagtacccccacatgctttctgtaagaaactgc ttcatcagaggttcggtagtgagatatgtgcaattacctccagaaggggtggacattgaa ttgttgcacgatgccacgaggagagaggctcggggcggttag

DBGET integrated database retrieval system