Phaseolus vulgaris (common bean): 137814248 Help Entry 137814248         CDS       T03093                                  Name (RefSeq) calmodulin-3-like   KO K02183   calmodulin Organism pvu  Phaseolus vulgaris (common bean) Pathway pvu04016   MAPK signaling pathway - plant pvu04070   Phosphatidylinositol signaling system pvu04075   Plant hormone signal transduction pvu04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:pvu00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     137814248    04070 Phosphatidylinositol signaling system     137814248    04075 Plant hormone signal transduction     137814248  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     137814248  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pvu01009]     137814248   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pvu04131]     137814248    03036 Chromosome and associated proteins [BR:pvu03036]     137814248   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pvu04147]     137814248 Protein phosphatases and associated proteins [BR:pvu01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      137814248 Membrane trafficking [BR:pvu04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     137814248 Chromosome and associated proteins [BR:pvu03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      137814248 Exosome [BR:pvu04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    137814248 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 SPARC_Ca_bdg EH EF_EFCAB10_C Dockerin_1 PA_Ig-like TerB DUF5580_M YqeY SurA_N_3 Motif Other DBs NCBI-GeneID:  137814248 NCBI-ProteinID:  XP_068472969 LinkDB All DBs Position 1:complement(40649738..40650781) Genome browser AA seq 148 aa AA seqDB search MEGALTDDQIAEFQEAFCLIDKDCDGFISVEELTTTFRSIVGNPTKKEIQDMISEVDIDG NGSIDFEEFLSIMGRKMKETLSEELKEAFKVFDRDEDGYISATELRNVMMSLGERLTDEE AEQMIRDADLDGDGQVSFDEFARIMMLK NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atggaaggtgcactgacggatgatcagattgctgaattccaagaagccttttgcctcatt gacaaggattgtgatggattcattagcgtggaggaattgacgaccactttccgatcaata gtagggaacccaacaaagaaagaaatccaagacatgatcagtgaggtggacattgatggt aatgggagtatagattttgaagagttcttgagtattatgggtagaaaaatgaaggaaact ttatctgaagagctgaaagaagccttcaaagtgtttgatagagatgaagacggatacata tccgccactgagctgaggaacgtaatgatgagtttgggagagaggctgacagatgaagag gcagaacaaatgatcagagatgcagatttggatggggatggccaagttagctttgatgaa tttgcgaggattatgatgctcaaatga

DBGET integrated database retrieval system