Phaseolus vulgaris (common bean): 137821716 Help Entry 137821716         CDS       T03093                                  Name (RefSeq) uncharacterized protein   KO K10418   dynein light chain LC8-type Organism pvu  Phaseolus vulgaris (common bean) Pathway pvu04145   Phagocytosis pvu04517   IgSF CAM signaling pvu04814   Motor proteins Brite KEGG Orthology (KO) [BR:pvu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     137821716  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     137821716   09142 Cell motility    04814 Motor proteins     137821716  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pvu03037]     137821716    04812 Cytoskeleton proteins [BR:pvu04812]     137821716 Cilium and associated proteins [BR:pvu03037]  Motile cilia and associated proteins   Dynein arm    137821716 Cytoskeleton proteins [BR:pvu04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      137821716 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light DUF5005 C19orf84 Motif Other DBs NCBI-GeneID:  137821716 NCBI-ProteinID:  XP_068482544 LinkDB All DBs Position 9:37054951..37059786 Genome browser AA seq 118 aa AA seqDB search MSEEVKKNIAGTPTAGPNTDDRKPLPAPAVPPKKVIIKSADMIPEMQKEAVDIAVATFEK YNVEKDVAEQIKKEFDKRHGPTWHCIVGRNFGSYVTHETNHFVYFYLDQKAVLLFKSG NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atgagtgaagaagtgaaaaagaacattgccgggacgccaacggcggggcccaacaccgat gaccggaagccgttaccggcaccggccgttcccccgaagaaggtcatcatcaagagcgcc gacatgatccccgaaatgcagaaggaggccgttgatatcgccgtcgcgacctttgagaag tacaatgtggagaaagatgttgcggagcagataaagaaggagttcgataagaggcatggc cccacttggcattgcatcgttggtcgtaattttggctcatatgtgactcatgaaacaaac cactttgtttatttctatttggatcaaaaagcggttttactcttcaaatctggctag

DBGET integrated database retrieval system