Phaseolus vulgaris (common bean): 137822731 Help Entry 137822731         CDS       T03093                                  Name (RefSeq) uncharacterized protein   KO K10418   dynein light chain LC8-type Organism pvu  Phaseolus vulgaris (common bean) Pathway pvu04145   Phagocytosis pvu04517   IgSF CAM signaling pvu04814   Motor proteins Brite KEGG Orthology (KO) [BR:pvu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     137822731  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     137822731   09142 Cell motility    04814 Motor proteins     137822731  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pvu03037]     137822731    04812 Cytoskeleton proteins [BR:pvu04812]     137822731 Cilium and associated proteins [BR:pvu03037]  Motile cilia and associated proteins   Dynein arm    137822731 Cytoskeleton proteins [BR:pvu04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      137822731 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  137822731 NCBI-ProteinID:  XP_068483795 LinkDB All DBs Position 11:complement(35009593..35010639) Genome browser AA seq 109 aa AA seqDB search MLEGKAVIGETDMLQTMQQDALDLASKALDVFDVTEAIEIARFIKKEFDRMHGPGWQCIV GTDFGSFVTHCCGCFIYFCLGNLAILLFRGSAAPEAHENQFSAVEAAKA NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atgctagaaggcaaggctgtgattggtgagactgacatgcttcagaccatgcagcaagat gccttggatttagcttccaaagcacttgatgtctttgatgtcactgaagccattgagatt gccagatttataaagaaggaatttgataggatgcatggacctggttggcagtgtattgta ggcactgattttggttcatttgtgacccactgttgtggctgtttcatctatttctgctta ggcaacttggccattttactcttcaggggctcagctgctccagaggcacatgaaaatcag ttctcagctgtagaggcagccaaagcataa

DBGET integrated database retrieval system