Phaseolus vulgaris (common bean): 137826289 Help Entry 137826289         CDS       T03093                                  Name (RefSeq) calmodulin   KO K02183   calmodulin Organism pvu  Phaseolus vulgaris (common bean) Pathway pvu04016   MAPK signaling pathway - plant pvu04070   Phosphatidylinositol signaling system pvu04075   Plant hormone signal transduction pvu04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:pvu00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     137826289    04070 Phosphatidylinositol signaling system     137826289    04075 Plant hormone signal transduction     137826289  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     137826289  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pvu01009]     137826289   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pvu04131]     137826289    03036 Chromosome and associated proteins [BR:pvu03036]     137826289   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pvu04147]     137826289 Protein phosphatases and associated proteins [BR:pvu01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      137826289 Membrane trafficking [BR:pvu04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     137826289 Chromosome and associated proteins [BR:pvu03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      137826289 Exosome [BR:pvu04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    137826289 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH SPARC_Ca_bdg EF_EFCAB10_C EF-hand_11 UPF0154 DUF5580_M EFhand_Ca_insen Dockerin_1 RNA_pol_Rpb4 Caleosin MotA_activ FCaBP_EF-hand SPEF2_C SurA_N_3 PA_Ig-like Fe_hyd_lg_C DUF6279 PhageMin_Tail MecA_N Motif Other DBs NCBI-GeneID:  137826289 NCBI-ProteinID:  XP_068488301 LinkDB All DBs Position 8:55373885..55376047 Genome browser AA seq 149 aa AA seqDB search MADQLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADVDGDGQINYEEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgatcaactcaccgacgagcagatctccgagttcaaggaagccttcagcctcttc gacaaggacggcgatggttgtattacaaccaaggaacttggaaccgtgatgaggtcactt gggcaaaacccaactgaggctgagctccaggacatgataaacgaggttgatgctgatggg aatggtaccattgatttcccagaattcctgaacctcatggcgcgcaagatgaaagacact gattcggaggaggagctgaaggaggccttccgcgtgtttgacaaggatcagaacggtttc atctctgctgcagagctccgccatgtgatgaccaatctcggcgagaagctgaccgacgag gaggttgacgagatgattcgcgaggcagatgttgacggtgacgggcagatcaactatgag gagtttgtcaaagtcatgatggccaagtga

DBGET integrated database retrieval system