Phaseolus vulgaris (common bean): 137828568 Help Entry 137828568         CDS       T03093                                  Name (RefSeq) calmodulin-like protein 11   KO K02183   calmodulin Organism pvu  Phaseolus vulgaris (common bean) Pathway pvu04016   MAPK signaling pathway - plant pvu04070   Phosphatidylinositol signaling system pvu04075   Plant hormone signal transduction pvu04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:pvu00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     137828568    04070 Phosphatidylinositol signaling system     137828568    04075 Plant hormone signal transduction     137828568  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     137828568  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pvu01009]     137828568   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pvu04131]     137828568    03036 Chromosome and associated proteins [BR:pvu03036]     137828568   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pvu04147]     137828568 Protein phosphatases and associated proteins [BR:pvu01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      137828568 Membrane trafficking [BR:pvu04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     137828568 Chromosome and associated proteins [BR:pvu03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      137828568 Exosome [BR:pvu04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    137828568 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_9 SPARC_Ca_bdg AIF-1 EH Dockerin_1 DUF5580_M EF-hand_11 EF_EFCAB10_C SurA_N_3 NADPH_Ox Caleosin DUF4378 SurA_N_2 YqeY DUF5663 DUF5580 UPF0154 RNase_PH_C Motif Other DBs NCBI-GeneID:  137828568 NCBI-ProteinID:  XP_068491289 LinkDB All DBs Position 7:complement(29437997..29438917) Genome browser AA seq 148 aa AA seqDB search MANAWTEDQIAIFHEAFDVVDKDSDGFITVEELISIVQSLDGNTPKEEVQEKISKVDIDG KGSVNFEEFLNVIGMTMKENLTEELKDAFKVFDRDNDGYISATELRHVMMKLGERLTEEE VEQMIREADLDGDGRVSYEEFARFMSLN NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atggcaaatgcatggacagaagatcaaatagctatattccacgaagcctttgatgttgtt gacaaggattccgacggtttcattactgtggaagaactgatatccattgttcagtcatta gatgggaacacgccaaaggaagaagttcaggaaaagattagtaaagtcgatatcgatgga aaaggaagtgtaaattttgaagagttcttgaatgttatcggaatgacaatgaaggaaaat ctgactgaggagctaaaagacgcgttcaaagtatttgacagggataatgatgggtacata tcagctacagagttgagacatgtgatgatgaaattgggagagaggctaacagaagaagaa gttgaacaaatgattagagaagcagatttggatggggatggtcgagttagctatgaagaa tttgcaaggtttatgtcattaaattga

DBGET integrated database retrieval system