Phaseolus vulgaris (common bean): 137829195 Help Entry 137829195         CDS       T03093                                  Name (RefSeq) SKP1-like protein 7   KO K03094   S-phase kinase-associated protein 1 Organism pvu  Phaseolus vulgaris (common bean) Pathway pvu03083   Polycomb repressive complex pvu04120   Ubiquitin mediated proteolysis pvu04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:pvu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     137829195    04120 Ubiquitin mediated proteolysis     137829195   09126 Chromosome    03083 Polycomb repressive complex     137829195  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pvu04131]     137829195    04121 Ubiquitin system [BR:pvu04121]     137829195    03036 Chromosome and associated proteins [BR:pvu03036]     137829195 Membrane trafficking [BR:pvu04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     137829195 Ubiquitin system [BR:pvu04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      137829195    Cul7 complex      137829195 Chromosome and associated proteins [BR:pvu03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      137829195   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      137829195 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Pkinase Motif Other DBs NCBI-GeneID:  137829195 NCBI-ProteinID:  XP_068492092 LinkDB All DBs Position 7:complement(18803300..18803659) Genome browser AA seq 119 aa AA seqDB search MRGKGEESEVVMLRKAEEEKSKAVKKVKLVTSDGVTIEVEISTVKEMETIQAFINATDTD DSVIFPLPRVSSHILSRIMELISKEYDQELVKRLSHEELKEICMVANYLTLLHRTSQKL NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgagaggaaaaggagaagagtcggaagttgttatgctaaggaaagcagaggaagaaaaa tcgaaggcagtaaaaaaggttaaactggtaacttcagatggagtgactatagaagtggaa atttcaactgtaaaagagatggagactattcaagctttcatcaacgccactgatactgac gattcagttatcttcccccttcccagagtttccagccacattctgagtcgaatcatggag ttgatatcaaaggaatatgatcaagaattggtgaagagacttagtcatgaagagttgaag gaaatttgtatggttgccaactatcttactcttctccatcgaacttcgcaaaagttatga

DBGET integrated database retrieval system