Phaseolus vulgaris (common bean): 137829919 Help Entry 137829919         CDS       T03093                                  Name (RefSeq) calmodulin-like   KO K02183   calmodulin Organism pvu  Phaseolus vulgaris (common bean) Pathway pvu04016   MAPK signaling pathway - plant pvu04070   Phosphatidylinositol signaling system pvu04075   Plant hormone signal transduction pvu04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:pvu00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     137829919    04070 Phosphatidylinositol signaling system     137829919    04075 Plant hormone signal transduction     137829919  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     137829919  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pvu01009]     137829919   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pvu04131]     137829919    03036 Chromosome and associated proteins [BR:pvu03036]     137829919   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pvu04147]     137829919 Protein phosphatases and associated proteins [BR:pvu01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      137829919 Membrane trafficking [BR:pvu04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     137829919 Chromosome and associated proteins [BR:pvu03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      137829919 Exosome [BR:pvu04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    137829919 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_8 EF-hand_6 EF-hand_5 EF-hand_9 EH AIF-1 Dockerin_1 Caleosin SPARC_Ca_bdg DUF5580_M EAP30 Mab-21 EFhand_Ca_insen Motif Other DBs NCBI-GeneID:  137829919 NCBI-ProteinID:  XP_068493045 LinkDB All DBs Position 7:complement(30711505..30712666) Genome browser AA seq 149 aa AA seqDB search MKEVLSENLIGDFLEAFCLFDRDGDGCITMEELASAIRVLNQNNPRKEELQVMMSEVDMN GNGMIDFGQFLNLMARKMKQSETEEELKEAFRLFDQDQDGYISPTELLSVMRNIGEKITE KELEEMIRVADLDGDGRLNYEEFVRMMTV NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atgaaggaagtgctaagtgaaaatctgattggcgattttctagaagccttctgtcttttt gacagagatggagatggctgcataaccatggaagaattagctagtgcaattagagtactg aatcagaataatcctaggaaggaagaactgcaagtcatgatgagtgaagtggatatgaat ggcaacggaatgatagattttgggcagttcttgaatctcatggccagaaaaatgaagcaa agtgaaacagaagaggaattgaaagaagctttcagactgtttgaccaggatcaagatggt tacatatcacccacagagttgttatctgtgatgagaaatattggagagaagatcacagaa aaagagctggaggagatgatcagagtggctgatttggatggtgatggtcgacttaattat gaagaattcgtgaggatgatgactgtttaa

DBGET integrated database retrieval system