Phaseolus vulgaris (common bean): 137830403 Help Entry 137830403         CDS       T03093                                  Name (RefSeq) DNA polymerase II subunit B4   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism pvu  Phaseolus vulgaris (common bean) Pathway pvu03030   DNA replication pvu03082   ATP-dependent chromatin remodeling pvu03410   Base excision repair pvu03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:pvu00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     137830403    03410 Base excision repair     137830403    03420 Nucleotide excision repair     137830403   09126 Chromosome    03082 ATP-dependent chromatin remodeling     137830403  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pvu03032]     137830403    03036 Chromosome and associated proteins [BR:pvu03036]     137830403    03400 DNA repair and recombination proteins [BR:pvu03400]     137830403 Enzymes [BR:pvu01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      137830403 DNA replication proteins [BR:pvu03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     137830403 Chromosome and associated proteins [BR:pvu03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     137830403 DNA repair and recombination proteins [BR:pvu03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       137830403 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone Vinculin LonB_AAA-LID Motif Other DBs NCBI-GeneID:  137830403 NCBI-ProteinID:  XP_068493825 LinkDB All DBs Position 11:9553138..9555052 Genome browser AA seq 151 aa AA seqDB search MAEAEELPRTIVRRVVKDKLSRCSEEGEISVSKDGLLAFSESGRIFIHYLSATANDICRE AKRQIITAEDVFKALEETEFSEFVRPLKASLEEFRKKNVGKKAAVSKGKEDESRKKRKLE AESSDKGEASNNDESSDKGEGSDKGEGEDNE NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atggctgaggccgaggaactgccccggactatcgtgcgccgtgttgtgaaggataaactg tcccgttgctctgaagaaggagaaatttccgtcagcaaagatggtcttctggcattctca gaaagcggtaggatcttcatccactacctttctgccacggccaatgacatatgtagggag gcaaagagacagattatcaccgcagaggatgttttcaaagctcttgaagaaaccgagttc tctgagtttgttcgtcctctaaaagcttcccttgaagagtttaggaagaagaatgttgga aagaaagcggcagtgtcaaagggaaaagaagatgagtcgagaaagaaaaggaaattggaa gctgagtcatctgataagggtgaggcatccaataatgacgagtcatctgataaaggggag ggttctgataaaggtgagggcgaggacaatgaatga

DBGET integrated database retrieval system