Phaseolus vulgaris (common bean): 137832411 Help Entry 137832411         CDS       T03093                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism pvu  Phaseolus vulgaris (common bean) Brite KEGG Orthology (KO) [BR:pvu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:pvu03041]     137832411   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pvu04052]     137832411 Spliceosome [BR:pvu03041]  Complex B   Other components    Complex B specific factors     137832411 Cytokines and neuropeptides [BR:pvu04052]  Neuropeptides   Unclassified    137832411 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 OTU1_UBXL Rad60-SLD Ubiquitin_4 Crinkler Motif Other DBs NCBI-GeneID:  137832411 NCBI-ProteinID:  XP_068496669 LinkDB All DBs Position 6:27058567..27059338 Genome browser AA seq 73 aa AA seqDB search MIEVVLNDRLGKKVRVKCNDDDTIGDLKKLVAAQTGTRADKIRIQKWYTIYKDHITLKDY EIHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggtggtgttgaacgaccgattgggaaagaaggtgcgcgtgaagtgcaacgat gatgacacaatcggcgacctgaagaagcttgtggcggctcagactggcaccagagccgac aagatccgcatccagaagtggtacaccatctacaaggatcacatcactctgaaggattac gagatccacgatggcatgggtctcgaactctactacaactaa

DBGET integrated database retrieval system