Plasmodium vinckei vinckei: PVVCY_1403140 Help Entry PVVCY_1403140     CDS       T08061                                  Name (RefSeq) dynein light chain 1, putative   KO K10418   dynein light chain LC8-type Organism pvv  Plasmodium vinckei vinckei Pathway pvv04517   IgSF CAM signaling pvv04814   Motor proteins Brite KEGG Orthology (KO) [BR:pvv00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     PVVCY_1403140  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     PVVCY_1403140  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pvv03037]     PVVCY_1403140    04812 Cytoskeleton proteins [BR:pvv04812]     PVVCY_1403140 Cilium and associated proteins [BR:pvv03037]  Motile cilia and associated proteins   Dynein arm    PVVCY_1403140 Cytoskeleton proteins [BR:pvv04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      PVVCY_1403140 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light CotJB Motif Other DBs NCBI-GeneID:  19959239 NCBI-ProteinID:  XP_008622936 UniProt:  A0A449C0A6 LinkDB All DBs Position PVVCY_14:1125302..1125583 Genome browser AA seq 93 aa AA seqDB search MADRKPNKNAVVKNVDMTEEMQIDAIDCANQALQKYNVEKDIAAHIKKEFDRKYDPTWHC VVGRNFGSYVTHETKNFIYFYIGQVAILLFKSG NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggctgatagaaaaccaaataaaaatgcggttgtaaaaaatgtagatatgacggaagaa atgcaaatcgatgccattgattgtgctaaccaagctctacaaaaatacaatgtcgaaaaa gatattgcagcacatataaaaaaagagtttgacagaaaatatgaccctacatggcattgt gtagtcggaaggaattttggatcatatgttacacatgaaactaagaattttatttatttc tatattggacaagtagctatattattgtttaaatccggatga

DBGET integrated database retrieval system