Pseudomonas vanderleydeniana: HU752_003240 Help Entry HU752_003240      CDS       T07587                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pvw  Pseudomonas vanderleydeniana Pathway pvw00998   Biosynthesis of various antibiotics pvw01100   Metabolic pathways pvw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pvw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HU752_003240    00074 Mycolic acid biosynthesis     HU752_003240   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HU752_003240 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QXI28994 UniProt:  A0A9E6TSS5 LinkDB All DBs Position complement(725979..726251) Genome browser AA seq 90 aa AA seqDB search MSDPTSALHLEIKELIIEALGLEDISVQDIGNEQTLFGEGLGLDSVDALELGLAIQKRYG IKIDADAKDTRDHFSSVASLAAFVTAKQAA NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgagcgatccaacaagcgccctgcaccttgaaatcaaggaactgatcatcgaggccctc ggcctcgaggacatcagcgtccaggacatcggcaacgagcaaacgctgttcggcgaaggc ctgggcctggactcggtggacgccctcgaactcggcctggccatccagaagcgctacggc atcaagatcgatgcggacgccaaggacacccgtgaccatttttccagcgtggccagcctt gcggctttcgtcacggcaaaacaggcagcgtga

DBGET integrated database retrieval system