Pseudomonas vanderleydeniana: HU752_007025 Help Entry HU752_007025      CDS       T07587                                  Symbol ftsB Name (GenBank) cell division protein FtsB   KO K05589   cell division protein FtsB Organism pvw  Pseudomonas vanderleydeniana Brite KEGG Orthology (KO) [BR:pvw00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pvw03036]     HU752_007025 (ftsB) Chromosome and associated proteins [BR:pvw03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     HU752_007025 (ftsB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC ACCA_BT NRBF2 YabA Motif Other DBs NCBI-ProteinID:  QXI29703 UniProt:  A0A9E6PNF6 LinkDB All DBs Position 1583943..1584221 Genome browser AA seq 92 aa AA seqDB search MRSPYWLFLVLLLLLAGLQYRLWVGNGSLAQVADLTQQIAEQHAENERLLERNRVLDAEV LELKKGMETVEERARHELGMVKDGETLYQLAQ NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgcgcagtccctactggttgttccttgtcctgctcttgctgctggctggcctgcagtac cgcctctgggtgggtaacgggagcctggcgcaggtagccgacctgacccaacagattgcc gagcagcatgccgagaacgaacgcctgctggagcgtaatcgcgtcctcgatgcagaagtt cttgaactgaagaaaggcatggagaccgttgaagaacgtgctcgccatgagctgggcatg gtcaaggacggcgaaaccctttatcagttggcacaatga

DBGET integrated database retrieval system