Pseudomonas vanderleydeniana: HU752_031245 Help Entry HU752_031245      CDS       T07587                                  Name (GenBank) TIGR02449 family protein   KO K09892   cell division protein ZapB Organism pvw  Pseudomonas vanderleydeniana Brite KEGG Orthology (KO) [BR:pvw00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pvw03036]     HU752_031245 Chromosome and associated proteins [BR:pvw03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     HU752_031245 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Asd-4 ZapB TPR_MLP1_2 VGPC1_C SOGA1-2-like_CC Motif Other DBs NCBI-ProteinID:  QXI28306 UniProt:  A0A9E6PLK2 LinkDB All DBs Position 6939712..6939921 Genome browser AA seq 69 aa AA seqDB search MEDNDLHALMARLELLINRVEQLKSQNGLLLAQEKTWREERAHLIEKNENARRKVESMIA RLKALEQDS NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggaagacaacgacctgcacgcactgatggccaggctcgaactgttgattaaccgggtc gagcaactaaaaagccaaaacggactcctattagctcaggaaaagacctggcgcgaggag cgcgcacaccttattgaaaagaacgaaaacgcccggcgcaaggttgaatcgatgattgcg cgcctcaaggccctggagcaagactcatga

DBGET integrated database retrieval system