Plasmodium vivax: PVX_080075 Help Entry PVX_080075        CDS       T01073                                  Name (RefSeq) hypothetical protein, conserved   KO K10420   dynein light chain Tctex-type 1/3 Organism pvx  Plasmodium vivax Pathway pvx04814   Motor proteins Brite KEGG Orthology (KO) [BR:pvx00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     PVX_080075  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pvx03037]     PVX_080075    04812 Cytoskeleton proteins [BR:pvx04812]     PVX_080075 Cilium and associated proteins [BR:pvx03037]  Motile cilia and associated proteins   Dynein arm    PVX_080075 Cytoskeleton proteins [BR:pvx04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      PVX_080075 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 Tab2-like_N Motif Other DBs NCBI-GeneID:  5472996 NCBI-ProteinID:  XP_001613723 UniProt:  A5K9C4 LinkDB All DBs Position 10:345890..347498 Genome browser AA seq 103 aa AA seqDB search MPRVCALAKVSKVSSNVTCHIKLRGKEKECAERIYSIVDDLLRNKTYSNSEINQWSNVIC ETSMDFLYSKLLPAKYIISCYILKSASTEAALRFSTYWDTGDS NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgcctcgagtgtgcgcgctcgctaaggtgtcaaaagtgtcttcaaatgttacttgccat attaagctacgtgggaaggaaaaggaatgcgccgagcgaatttattccatagtcgacgac cttttgaggaataaaacctactccaacagtgaaataaaccagtggtcaaatgtcatctgc gaaacgtccatggattttctgtactcgaaattgttgcccgcgaagtacataataagctgc tacattttaaaaagtgcaagcacggaagcggctctccgattttctacctactgggacacg ggggatagttaa

DBGET integrated database retrieval system