Plasmodium vivax: PVX_100840 Help Entry PVX_100840        CDS       T01073                                  Name (RefSeq) ubiquitin-like protein, putative   KO K13113   ubiquitin-like protein 5 Organism pvx  Plasmodium vivax Brite KEGG Orthology (KO) [BR:pvx00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:pvx03041]     PVX_100840   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pvx04052]     PVX_100840 Spliceosome [BR:pvx03041]  Complex B   Other components    Complex B specific factors     PVX_100840 Cytokines and neuropeptides [BR:pvx04052]  Neuropeptides   Unclassified    PVX_100840 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Rad60-SLD Ubiquitin_4 OTU1_UBXL Crinkler Motif Other DBs NCBI-GeneID:  5473195 NCBI-ProteinID:  XP_001613914 UniProt:  A0A1G4H5R2 A5K8P1 LinkDB All DBs Position 14:2418282..2419487 Genome browser AA seq 73 aa AA seqDB search MIEIILNDRLGKKIRVKCNPDDTIGDLKKLVAAQTGTRADKIRIQKWYTIYKDHITLQDY EIKDGMSLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatagaaataatactgaacgaccggctggggaagaaaatccgcgtgaagtgcaacccg gatgacaccatcggggatttgaagaagctcgtggcggcgcaaacgggaaccagggccgac aaaatacgaatacaaaaatggtacaccatttacaaggaccacatcactctgcaagattac gaaattaaggacgggatgagtctcgagctatattataactga

DBGET integrated database retrieval system