Pistacia vera (pistachio): 116121956 Help Entry 116121956         CDS       T07386                                  Name (RefSeq) calmodulin-like   KO K02183   calmodulin Organism pvy  Pistacia vera (pistachio) Pathway pvy04016   MAPK signaling pathway - plant pvy04070   Phosphatidylinositol signaling system pvy04075   Plant hormone signal transduction pvy04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:pvy00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     116121956    04070 Phosphatidylinositol signaling system     116121956    04075 Plant hormone signal transduction     116121956  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     116121956  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pvy01009]     116121956   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pvy04131]     116121956    03036 Chromosome and associated proteins [BR:pvy03036]     116121956   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pvy04147]     116121956 Protein phosphatases and associated proteins [BR:pvy01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      116121956 Membrane trafficking [BR:pvy04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     116121956 Chromosome and associated proteins [BR:pvy03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      116121956 Exosome [BR:pvy04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    116121956 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_9 AIF-1 SPARC_Ca_bdg EH Dockerin_1 EF_EFCAB10_C DUF5580_M Caleosin PA_Ig-like Fe_hyd_lg_C CdiI_ImmP Motif Other DBs NCBI-GeneID:  116121956 NCBI-ProteinID:  XP_031263718 LinkDB All DBs Position Unknown AA seq 148 aa AA seqDB search MADSLTEQQIAEFQEAFCMIDKDSDGFITMEELAAVIQSLEGNPTKQEVREMISEVDFDG NGNIDIEEFLNIMGRKMKDNVAEELKEAFKVFDRDQDGYISANELRNVMMNLGEKLTVEE AEQMIREADLDGDGLVSYEEFSRMMSAF NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atggcagattcactgacagaacagcaaattgctgagttccaggaggccttttgtatgatt gacaaagactcagatggttttatcacgatggaagagcttgcagcagtgatccaatcactg gaaggaaatcctacaaagcaggaagttcgagagatgattagtgaagttgattttgatgga aacgggaatatagatatcgaagagttcttgaatatcatgggaagaaagatgaaggataat gttgcagaagagctaaaagaagcttttaaagtatttgacagagatcaagacggatatata tcagctaatgagctgagaaatgtgatgatgaatctgggagagaaattaacggttgaagaa gctgaacaaatgataagagaggccgatttagatggtgatggcctcgtcagctacgaggaa ttttcaagaatgatgtcggcattctga

DBGET integrated database retrieval system