Pistacia vera (pistachio): 116123841
Help
Entry
116123841 CDS
T07386
Name
(RefSeq) SKP1-like protein 1B
KO
K03094
S-phase kinase-associated protein 1
Organism
pvy
Pistacia vera (pistachio)
Pathway
pvy03083
Polycomb repressive complex
pvy04120
Ubiquitin mediated proteolysis
pvy04141
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:
pvy00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
116123841
04120 Ubiquitin mediated proteolysis
116123841
09126 Chromosome
03083 Polycomb repressive complex
116123841
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
pvy04131
]
116123841
04121 Ubiquitin system [BR:
pvy04121
]
116123841
03036 Chromosome and associated proteins [BR:
pvy03036
]
116123841
Membrane trafficking [BR:
pvy04131
]
Endosome - Lysosome transport
Acidification regulators
RAVE complex
116123841
Ubiquitin system [BR:
pvy04121
]
Ubiquitin ligases (E3)
Multi subunit type E3
SCF complex
Adaptor protein
116123841
Cul7 complex
116123841
Chromosome and associated proteins [BR:
pvy03036
]
Eukaryotic type
Histone modification proteins
Polycomb repressive complex (PRC) and associated proteins
Noncanonical PRC1 (PRC1.1)
116123841
Centromeric chromatin formation proteins
Kinetochore proteins
CBF3 complex
116123841
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
Skp1
Skp1_POZ
Methyltransf_16
Motif
Other DBs
NCBI-GeneID:
116123841
NCBI-ProteinID:
XP_031265435
LinkDB
All DBs
Position
Unknown
AA seq
157 aa
AA seq
DB search
MSTSKKITLKSSDGEAFEVDEVVALESQTIKHMIEDDCADNGIPLPNVTSKILSKVIEYC
KKHVEATKADDRAAGVDEELKAWDAEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVAD
MIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE
NT seq
474 nt
NT seq
+upstream
nt +downstream
nt
atgtcaacgagcaagaaaattactctgaaaagctccgatggtgaggcgttcgaggtagat
gaagtggtggctttggaatcgcagacgataaagcatatgatagaggacgattgcgccgac
aacggaattcctcttcctaatgtaaccagcaagatcctctccaaggtcatcgagtactgc
aagaagcacgttgaggctaccaaggccgacgatcgtgcagccggcgtcgacgaagaactc
aaggcctgggatgccgagttcgtcaaagtcgatcaggctacccttttcgatctcatcctc
gctgcaaactatctcaacatcaagagcttgctggacctgacttgccagacagttgcagac
atgattaagggaaaaactccagaggagattcgcaaaacattcaacattaagaatgacttt
actccagaagaggaggaggaggttcgccgggagaatcagtgggcttttgagtga
DBGET
integrated database retrieval system