Pistacia vera (pistachio): 116126057 Help Entry 116126057         CDS       T07386                                  Name (RefSeq) thioredoxin-like 3-3   KO K03671   thioredoxin Organism pvy  Pistacia vera (pistachio) Brite KEGG Orthology (KO) [BR:pvy00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:pvy03110]     116126057 Chaperones and folding catalysts [BR:pvy03110]  Protein folding catalysts   Protein disulfide isomerase    116126057 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Motif Other DBs NCBI-GeneID:  116126057 NCBI-ProteinID:  XP_031267622 LinkDB All DBs Position Unknown AA seq 76 aa AA seqDB search MIFRCRVCSQILPAFCKLSNNFPKLSFVYADIDECPETTQHIRYTPTFHFYRDGERVDEM FGAGEERLHDRLWLHS NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgattttcaggtgcagagtgtgcagccagattctgccagcattttgcaagctgagtaat aacttccccaagctttccttcgtatatgcggatattgatgaatgcccagaaacaactcaa catattcgttacacacccacatttcatttctaccgtgatggcgaaagagtcgatgagatg tttggtgctggagaggaaagacttcacgatcgattgtggttgcactcctga

DBGET integrated database retrieval system