Pistacia vera (pistachio): 116144979 Help Entry 116144979         CDS       T07386                                  Name (RefSeq) elongin-C-like   KO K03872   elongin-C Organism pvy  Pistacia vera (pistachio) Pathway pvy04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:pvy00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     116144979  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pvy04121]     116144979    03400 DNA repair and recombination proteins [BR:pvy03400]     116144979 Ubiquitin system [BR:pvy04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      116144979    Cul5 complex      116144979 DNA repair and recombination proteins [BR:pvy03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      116144979 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  116144979 NCBI-ProteinID:  XP_031286294 LinkDB All DBs Position Unknown AA seq 101 aa AA seqDB search MKKEDTVKLISAEGFEFVIDKEAAMVSQTIRNMLTSPGSFAETQDGKVTFPEISTTILEK ICQYFYWSLQYARFCFFFSNLYSFVETLLQSIDVFTCLLIL NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgaagaaggaagacacggtgaagctgatcagcgcggagggcttcgagttcgtgatcgac aaggaagctgccatggtttcgcagaccatccgcaacatgctcacctctccggggagtttt gctgaaacacaggatggaaaagtgacattccctgagataagcaccaccattttggagaag atctgccaatatttttattggtctcttcagtatgccaggttctgttttttctttagtaat ttgtattcttttgtggagacattattgcagtctattgatgtatttacttgtcttttgata ctgtaa

DBGET integrated database retrieval system