Pectobacterium versatile: OA04_43530 Help Entry OA04_43530        CDS       T07772                                  Name (GenBank) hypothetical protein   KO K09892   cell division protein ZapB Organism pvz  Pectobacterium versatile Brite KEGG Orthology (KO) [BR:pvz00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pvz03036]     OA04_43530 Chromosome and associated proteins [BR:pvz03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     OA04_43530 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB CtIP_N Seryl_tRNA_N Leu_zip CC149 PspA_IM30 ERM_helical DUF3450 XRCC4_CC USHBP1_PDZ-bd CC2-LZ YabA UPF0242 Herpes_UL6 Nuf2_DHR10-like FlaC_arch SlyX DUF2968 DUF16 APG6_N Motif Other DBs NCBI-ProteinID:  AVT60796 LinkDB All DBs Position complement(4719757..4719996) Genome browser AA seq 79 aa AA seqDB search MSFEVFEKLEAKVQQAIDTITLLQMEIEELKEQNNALSQDVQAAAGSREALVRENEQLKE EQVVWQERLRALLGKMEEV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtcatttgaagtgtttgaaaagctggaagcgaaagttcagcaggcgattgataccatc acgctgttgcaaatggaaattgaagagctgaaagagcagaacaacgcgctgtcgcaggat gttcaggcggcagcgggttcacgtgaagcgctggtgcgcgagaacgagcaattgaaagaa gagcaagtggtatggcaagagcgcctgcgcgcgctgttaggcaaaatggaagaagtctaa

DBGET integrated database retrieval system