Pectobacterium parmentieri WPP163: Pecwa_3093 Help Entry Pecwa_3093        CDS       T01106                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism pwa  Pectobacterium parmentieri WPP163 Pathway pwa00190   Oxidative phosphorylation pwa01100   Metabolic pathways pwa02020   Two-component system Module pwa_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:pwa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     Pecwa_3093  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     Pecwa_3093 Enzymes [BR:pwa01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      Pecwa_3093 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  ACX88835 LinkDB All DBs Position complement(3369632..3369748) Genome browser AA seq 38 aa AA seqDB search MWYFAWILGTLLACSLGIITALAIEQSEASKAVEDDKQ NT seq 117 nt NT seq  +upstreamnt  +downstreamnt atgtggtattttgcctggatactcggaacgcttcttgcttgctcactggggatcatcacg gccctggctatcgagcagagtgaggcaagcaaagcggttgaagacgataagcaatga

DBGET integrated database retrieval system