Pyrococcus woesei: ACMFNG_04250 Help Entry ACMFNG_04250      CDS       T11319                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism pwe  Pyrococcus woesei Pathway pwe03010   Ribosome Brite KEGG Orthology (KO) [BR:pwe00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     ACMFNG_04250   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     ACMFNG_04250  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:pwe03011]     ACMFNG_04250    04121 Ubiquitin system [BR:pwe04121]     ACMFNG_04250   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pwe04147]     ACMFNG_04250 Ribosome [BR:pwe03011]  Ribosomal proteins   Eukaryotes    Small subunit     ACMFNG_04250   Archaea     ACMFNG_04250 Ubiquitin system [BR:pwe04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    ACMFNG_04250 Exosome [BR:pwe04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    ACMFNG_04250   Exosomal proteins of colorectal cancer cells    ACMFNG_04250 SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_S27 Ribosomal_L37e Cas12f1-like_TNB Zn_ribbon_NUD Zn_ribbon_IS1595 Zn_ribbon_Nudix Zn_ribbon_RPB9 GFA MqsA_antitoxin Zn_Ribbon_1 Motif Other DBs NCBI-ProteinID:  XTU90494 LinkDB All DBs Position complement(759124..759276) Genome browser AA seq 50 aa AA seqDB search MGQKWKLYEIKDGKVIRKNKFCPRCGPGVFMADHGDRWACGKCGYTEWKK NT seq 153 nt NT seq  +upstreamnt  +downstreamnt atgggacagaagtggaagctctacgagattaaggatgggaaagttataagaaagaacaag ttctgcccgcgctgtggcccaggagtattcatggcagatcacggggataggtgggcctgt gggaagtgtggatatacagagtggaagaagtga

DBGET integrated database retrieval system