Pyrococcus woesei: ACMFNG_10290 Help Entry ACMFNG_10290      CDS       T11319                                  Name (GenBank) 50S ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism pwe  Pyrococcus woesei Pathway pwe03010   Ribosome Brite KEGG Orthology (KO) [BR:pwe00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     ACMFNG_10290   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     ACMFNG_10290  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:pwe03011]     ACMFNG_10290    04121 Ubiquitin system [BR:pwe04121]     ACMFNG_10290 Ribosome [BR:pwe03011]  Ribosomal proteins   Eukaryotes    Large subunit     ACMFNG_10290   Archaea     ACMFNG_10290 Ubiquitin system [BR:pwe04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    ACMFNG_10290 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Zn_Ribbon_1 Ribosomal_L40e DZR Zn_ribbon_3 Zn_ribbon_RPAB4 HVO_0416 Motif Other DBs NCBI-ProteinID:  XTU89729 LinkDB All DBs Position 1849085..1849240 Genome browser AA seq 51 aa AA seqDB search MARFPEAEARIFKKYVCLRCGATNPWGAKKCRKCGYKRLRPKAKEPRGGGR NT seq 156 nt NT seq  +upstreamnt  +downstreamnt atggcgaggttcccagaagcagaggcgagaatattcaaaaagtacgtgtgcttaagatgt ggagcaactaacccatggggagccaaaaagtgcagaaagtgcggatacaagaggctaagg ccaaaagctaaagaaccaagaggaggaggacgctga

DBGET integrated database retrieval system