Paenibacillus woosongensis: QNH46_09075 Help Entry QNH46_09075       CDS       T09437                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pwn  Paenibacillus woosongensis Pathway pwn00998   Biosynthesis of various antibiotics pwn01100   Metabolic pathways pwn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pwn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     QNH46_09075    00074 Mycolic acid biosynthesis     QNH46_09075   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     QNH46_09075 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 CSN4_RPN5_eIF3a Motif Other DBs NCBI-ProteinID:  WHX50778 UniProt:  A0AA95IE07 LinkDB All DBs Position 2027046..2027276 Genome browser AA seq 76 aa AA seqDB search MERLKKIIQDLCFQTQEINENTSLLTDLGFDSLQILRLLVEIENEYKFKISYDSIDYEIF NKYGELEAYVTSKIQS NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggaaagactaaaaaaaataatacaagacttatgtttccagacccaggaaataaatgag aataccagtttgctgacggatcttggctttgattctcttcaaatattaagacttttggtt gagatagaaaatgagtataaattcaaaatttcttatgattcaatagattacgaaatattt aacaagtatggagaacttgaggcttatgtaaccagcaaaatccaaagttga

DBGET integrated database retrieval system