KEGG   Paenibacillus woosongensis: QNH46_15060
Entry
QNH46_15060       CDS       T09437                                 
Name
(GenBank) aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Organism
pwn  Paenibacillus woosongensis
Pathway
pwn00260  Glycine, serine and threonine metabolism
pwn00261  Monobactam biosynthesis
pwn00270  Cysteine and methionine metabolism
pwn00300  Lysine biosynthesis
pwn01100  Metabolic pathways
pwn01110  Biosynthesis of secondary metabolites
pwn01120  Microbial metabolism in diverse environments
pwn01210  2-Oxocarboxylic acid metabolism
pwn01230  Biosynthesis of amino acids
Module
pwn_M00017  Methionine biosynthesis, aspartate => homoserine => methionine
pwn_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
pwn_M00526  Lysine biosynthesis, DAP dehydrogenase pathway, aspartate => lysine
pwn_M00527  Lysine biosynthesis, DAP aminotransferase pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:pwn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    QNH46_15060
   00270 Cysteine and methionine metabolism
    QNH46_15060
   00300 Lysine biosynthesis
    QNH46_15060
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    QNH46_15060
Enzymes [BR:pwn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     QNH46_15060
SSDB
Motif
Pfam: AA_kinase ACT_9 ACT_7 ACT ACT_4
Other DBs
NCBI-ProteinID: WHX47472
UniProt: A0AA95L193
LinkDB
Position
complement(3266279..3267532)
AA seq 417 aa
MALFVMKFGGSSVGDTERMQRVARRIAEKQDEGHQVVVVVSAMGDTTDDLIDQAKQLSKE
PPLREMDMLMTTGEQISISLLSIAIHALGRKAVSFTGWQAGFRTDKEHSRARITDIQPQR
VQAALDEGNIVVVAGFQGISEDGEITTFGRGGSDTTAVALAAAISADYCEIYTDVDGIYS
TDPRIVKNARKLKEISYDEMLELANLGAAVLHPRAVEYAKHNHVRLVVRSSFNHNEGTVV
KEEVKMEQGVVVSGIAYDKNVARISILGVSHIPGVLAQVFGSLAEAKIDVDIIVQSGVQN
GKADFSFTVSLTDLKKALQVINGIRGSLPFDEVTSEEGLVKVSIVGAGMVSHPGVAAKMF
DVISKQDVNIKMVSTSEIKVSCVIEGTKLNEVVKALHTAYGLDTESQVFVGGPQERR
NT seq 1254 nt   +upstreamnt  +downstreamnt
ttggctttatttgtgatgaagtttgggggaagttctgtcggcgatacggaacggatgcag
cgcgtagcccggcgcatcgccgagaagcaggatgagggacatcaggtcgttgtggtggtg
tccgccatgggagatacgacggatgatttaattgatcaggcgaagcagctcagcaaggag
ccgcctttgcgtgaaatggatatgctgatgacgaccggtgagcagatttcgatttcgttg
ctatcgatcgcgattcatgcgctgggccgcaaggctgtgtcatttaccggctggcaggct
ggtttccgtacggataaagagcattccagagcccgtattaccgatattcagccgcagcga
gtacaagcggcgctggatgaaggaaatatcgtcgtcgttgcaggattccaagggattagc
gaggacggggagattacgacgttcgggcgcggcggctcggatacgaccgcggtcgccttg
gcagcggccatttccgccgattactgtgaaatttatacagacgtagacggaatctactct
acggacccgcggatcgtcaagaatgctcgcaagctgaaggaaatatcctatgacgaaatg
ctggagctggccaacctgggagccgccgtgcttcacccgcgtgcagtagagtatgcgaag
cataatcatgttcgtctcgtcgttcgttcaagctttaatcataatgagggtacggttgtt
aaggaggaagtgaaaatggagcaaggcgtagtagtcagcggaatagcttacgataaaaat
gtagcaagaatcagcattttgggcgtatcccatattcctggagttttagcccaggtgttc
ggttctttggctgaagcaaaaatcgatgtagacatcatcgtacaaagcggcgtgcagaac
ggcaaggcggatttctccttcaccgtatctttgacagatttgaagaaggcgctgcaggtc
attaatggaattcgcggcagccttccattcgatgaggttacttcggaagagggattggtc
aaagtgtcgatcgtcggggccggcatggttagccatccaggcgtggcggcgaaaatgttc
gatgtcatttccaaacaggacgttaacatcaagatggtgagcacctcggaaatcaaagta
tcctgcgttatcgagggtacgaagctcaatgaggtggtcaaagcactgcacaccgcttat
ggcctggacaccgaaagccaagtgttcgtcggtggaccgcaggagcgccgctaa

DBGET integrated database retrieval system