Paenibacillus woosongensis: QNH46_18480
Help
Entry
QNH46_18480 CDS
T09437
Name
(GenBank) YkoF family thiamine/hydroxymethylpyrimidine-binding protein
KO
K24620
energy-coupling factor transport system substrate-specific component
Organism
pwn
Paenibacillus woosongensis
Brite
KEGG Orthology (KO) [BR:
pwn00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
pwn02000
]
QNH46_18480
Transporters [BR:
pwn02000
]
ABC transporters, prokaryotic type
Metallic cation, iron-siderophore and vitamin B12 transporters
Energy-coupling factor transporter
QNH46_18480
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ykof
Thiamine_BP
Rap1_C
Motif
Other DBs
NCBI-ProteinID:
WHX48083
UniProt:
A0AA95KSU5
LinkDB
All DBs
Position
4035239..4035874
Genome browser
AA seq
211 aa
AA seq
DB search
MTNSFNHNIQAAACGTSRIVGCRFSLFPMSDRFVPIILGALEHTDTSKVWVQSDDVSTCV
RGRHEHVFDVVKSIFLQAAKSGEHVVLSATFSVGCPGDTEGDVFMSEDDVRLNEGNKTSV
DTAAQFALYPMGVPHYMDVIYDAVKAAEAEGTFSGGIHYASRLDGTAQQVFRSLENAFVT
SSTKTSHLVMTATISCNSPSAKPEHVQRKGE
NT seq
636 nt
NT seq
+upstream
nt +downstream
nt
atgaccaattcattcaaccacaacattcaagccgcggcctgcggcaccagccgcatcgtc
ggctgccggttctctctgtttccgatgagcgaccggttcgttccgatcattcttggagcg
ctggagcataccgatacgtccaaggtctgggttcaaagcgatgacgtcagcacctgcgtg
cgcggccgccatgagcatgtgttcgacgtagttaaatccattttcctgcaggcggcaaaa
agcggtgagcatgtcgttcttagcgcaaccttttccgtaggctgcccgggagatacggaa
ggagatgtcttcatgtctgaggacgatgtccgtttgaacgaagggaacaaaacatcggtt
gataccgcagctcaattcgccctttacccgatgggggtgccccactacatggacgtcatt
tatgatgcggtcaaagcggcggaagccgagggaacgttctccggcggaattcattacgct
agccgcctggatggaaccgcccaacaggtgtttcgttcactcgaaaatgcctttgtcacg
tcaagcaccaagacttcccatctagtcatgacggccacaatctcctgcaacagcccgtca
gccaaaccggagcatgtgcagaggaagggggaataa
DBGET
integrated database retrieval system