KEGG   Paenibacillus woosongensis: QNH46_18480
Entry
QNH46_18480       CDS       T09437                                 
Name
(GenBank) YkoF family thiamine/hydroxymethylpyrimidine-binding protein
  KO
K24620  energy-coupling factor transport system substrate-specific component
Organism
pwn  Paenibacillus woosongensis
Brite
KEGG Orthology (KO) [BR:pwn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pwn02000]
    QNH46_18480
Transporters [BR:pwn02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Energy-coupling factor transporter
    QNH46_18480
SSDB
Motif
Pfam: Ykof Thiamine_BP Rap1_C
Other DBs
NCBI-ProteinID: WHX48083
UniProt: A0AA95KSU5
LinkDB
Position
4035239..4035874
AA seq 211 aa
MTNSFNHNIQAAACGTSRIVGCRFSLFPMSDRFVPIILGALEHTDTSKVWVQSDDVSTCV
RGRHEHVFDVVKSIFLQAAKSGEHVVLSATFSVGCPGDTEGDVFMSEDDVRLNEGNKTSV
DTAAQFALYPMGVPHYMDVIYDAVKAAEAEGTFSGGIHYASRLDGTAQQVFRSLENAFVT
SSTKTSHLVMTATISCNSPSAKPEHVQRKGE
NT seq 636 nt   +upstreamnt  +downstreamnt
atgaccaattcattcaaccacaacattcaagccgcggcctgcggcaccagccgcatcgtc
ggctgccggttctctctgtttccgatgagcgaccggttcgttccgatcattcttggagcg
ctggagcataccgatacgtccaaggtctgggttcaaagcgatgacgtcagcacctgcgtg
cgcggccgccatgagcatgtgttcgacgtagttaaatccattttcctgcaggcggcaaaa
agcggtgagcatgtcgttcttagcgcaaccttttccgtaggctgcccgggagatacggaa
ggagatgtcttcatgtctgaggacgatgtccgtttgaacgaagggaacaaaacatcggtt
gataccgcagctcaattcgccctttacccgatgggggtgccccactacatggacgtcatt
tatgatgcggtcaaagcggcggaagccgagggaacgttctccggcggaattcattacgct
agccgcctggatggaaccgcccaacaggtgtttcgttcactcgaaaatgcctttgtcacg
tcaagcaccaagacttcccatctagtcatgacggccacaatctcctgcaacagcccgtca
gccaaaccggagcatgtgcagaggaagggggaataa

DBGET integrated database retrieval system