Pectobacterium wasabiae: A7983_07675 Help Entry A7983_07675       CDS       T04535                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pws  Pectobacterium wasabiae Pathway pws00998   Biosynthesis of various antibiotics pws01100   Metabolic pathways pws01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pws00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A7983_07675    00074 Mycolic acid biosynthesis     A7983_07675   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A7983_07675 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AOR63137 LinkDB All DBs Position complement(1714420..1714686) Genome browser AA seq 88 aa AA seqDB search MESLFIEIKEMIIDSLNLEDISVDEIETDAPLFGEGLGLDSIDALELGLAVKNRYGVVLS AESEEVRQHFFSVATLAAFINTQRAVSA NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atggaaagtctatttattgaaatcaaagagatgattattgattctcttaatcttgaagat attagcgttgatgaaatagaaacagacgccccgctttttggcgagggtcttggtctggat tctatcgatgcacttgaactggggttggcggttaaaaaccgttatggcgtcgtgctttct gctgagagtgaagaagtgcgccaacacttcttttccgttgctacccttgccgcttttatc aacactcagcgcgctgtgagtgcctga

DBGET integrated database retrieval system