Pectobacterium wasabiae: A7983_21760 Help Entry A7983_21760       CDS       T04535                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pws  Pectobacterium wasabiae Pathway pws00998   Biosynthesis of various antibiotics pws01100   Metabolic pathways pws01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pws00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A7983_21760    00074 Mycolic acid biosynthesis     A7983_21760   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A7983_21760 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 EutQ Motif Other DBs NCBI-ProteinID:  AOR65842 LinkDB All DBs Position complement(4795020..4795256) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIVEQLGVKQEEVVNNASFVDDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDFIQANQQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaatcatcgttgaacagcttggtgttaagcag gaagaagtcgtaaacaatgcttctttcgttgatgacctcggcgctgattctcttgacact gttgagctggtaatggctctggaagaagaatttgatactgagattccagacgaagaagct gaaaaaatcacgactgttcaggcagccattgatttcattcaggctaaccagcagtaa

DBGET integrated database retrieval system