Polynucleobacter wuianus: A8O14_04590 Help Entry A8O14_04590       CDS       T09802                                  Name (GenBank) histone   KO K03746   DNA-binding protein H-NS Organism pwu  Polynucleobacter wuianus Brite KEGG Orthology (KO) [BR:pwu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pwu03036]     A8O14_04590    03400 DNA repair and recombination proteins [BR:pwu03400]     A8O14_04590 Chromosome and associated proteins [BR:pwu03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     A8O14_04590 DNA repair and recombination proteins [BR:pwu03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       A8O14_04590 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Motif Other DBs NCBI-ProteinID:  ANI99434 UniProt:  A0A191UEJ2 LinkDB All DBs Position 867027..867311 Genome browser AA seq 94 aa AA seqDB search MSSYKELLAQREQLDKQIKEAIAREKADGIAKAKLIIEQYDLNASDLFSRKAGGKSAVGK VAPKYRNPSTGETWTGRGKAPKWIEGRDRSNYLI NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgtcttcttataaagaacttttagctcagcgcgagcaactagataaacagattaaagaa gcgattgcccgtgaaaaagctgacggcatcgccaaggccaagctcattattgagcagtac gacctcaatgcttcggacttatttagtcgtaaagcaggcggtaagagtgccgttggtaag gtcgcccctaagtatcgcaatccatcaactggtgaaacttggacgggtcgtggtaaggct cctaagtggattgagggtagagatcgtagcaactacctgatctag

DBGET integrated database retrieval system