Pseudomonas wayambapalatensis: HU734_000080 Help Entry HU734_000080      CDS       T08016                                  Name (GenBank) TIGR02449 family protein   KO K09892   cell division protein ZapB Organism pwy  Pseudomonas wayambapalatensis Brite KEGG Orthology (KO) [BR:pwy00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pwy03036]     HU734_000080 Chromosome and associated proteins [BR:pwy03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     HU734_000080 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Filament ADIP Asd-4 ZapB Motif Other DBs NCBI-ProteinID:  QXI43225 LinkDB All DBs Position 16972..17181 Genome browser AA seq 69 aa AA seqDB search MQDNDLQALMSRFELLIERVEQLKRQNALLVAQEKSWREERAHLIEKNEIARHKIESMIL RLKALEQDS NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgcaagacaatgacctgcaagcgctgatgagccgattcgagttgctgatcgagcgcgtc gagcaactaaaacggcaaaatgcactcctagtagctcaggaaaaatcctggcgcgaagag cgcgcccacctcatcgaaaagaacgagatcgcccggcacaagatcgagtcgatgatcttg cgtctgaaggccctggagcaagactcatga

DBGET integrated database retrieval system