Pseudomonas wayambapalatensis: HU734_003515 Help Entry HU734_003515      CDS       T08016                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism pwy  Pseudomonas wayambapalatensis Pathway pwy02024   Quorum sensing pwy03018   RNA degradation Brite KEGG Orthology (KO) [BR:pwy00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     HU734_003515 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     HU734_003515 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pwy03019]     HU734_003515 (hfq)    03036 Chromosome and associated proteins [BR:pwy03036]     HU734_003515 (hfq) Messenger RNA biogenesis [BR:pwy03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      HU734_003515 (hfq) Chromosome and associated proteins [BR:pwy03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     HU734_003515 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  QXI43870 LinkDB All DBs Position 793020..793280 Genome browser AA seq 86 aa AA seqDB search MSKGHSLQDPYLNTLRKEKVPVSIYLVNGIKLQGQIESFDQFVVLLKNTVSQMVYKHAIS TVVPARPVRLPSPSDSEHGDSEPGNA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgtcaaaagggcattcgctacaagacccttacttgaacaccttgagaaaagaaaaggtc ccggtttcgatctacctggtcaacggcatcaagctgcaaggccagatcgagtccttcgac cagttcgtcgtgctgctgaagaacaccgtcagccagatggtctacaagcacgcgatttcc actgtcgtacctgcccgtccggttcgtctgccaagcccgtccgattccgaacacggcgac agcgagccaggcaacgcctga

DBGET integrated database retrieval system