Pseudomonas wayambapalatensis: HU734_018210 Help Entry HU734_018210      CDS       T08016                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pwy  Pseudomonas wayambapalatensis Pathway pwy01100   Metabolic pathways pwy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pwy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HU734_018210 (acpP)    00074 Mycolic acid biosynthesis     HU734_018210 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HU734_018210 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C TerB DUF1896 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QXI42171 LinkDB All DBs Position complement(4092227..4092463) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVKNESSFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQAAIDYVNSHKA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaaaatcgtcgccgagcaactgggcgtcaaggaa gaggaagtcaagaacgaatcttccttcgttgaagacctgggtgccgattcgcttgacacc gttgagctggtgatggctctggaagaggaattcgagaccgaaatccctgacgaagaagcc gagaagatcactaccgttcaagctgcaatcgactacgtcaacagccacaaggcctaa

DBGET integrated database retrieval system