Pseudomonas wenzhouensis: J7655_03190 Help Entry J7655_03190       CDS       T07852                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism pwz  Pseudomonas wenzhouensis Pathway pwz02024   Quorum sensing pwz03018   RNA degradation Brite KEGG Orthology (KO) [BR:pwz00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     J7655_03190 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     J7655_03190 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pwz03019]     J7655_03190 (hfq)    03036 Chromosome and associated proteins [BR:pwz03036]     J7655_03190 (hfq) Messenger RNA biogenesis [BR:pwz03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      J7655_03190 (hfq) Chromosome and associated proteins [BR:pwz03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     J7655_03190 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Gag_p24_C Motif Other DBs NCBI-ProteinID:  UFQ98246 LinkDB All DBs Position 702442..702702 Genome browser AA seq 86 aa AA seqDB search MSKGHSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS TVVPSRPVRLPSAGDAEQGDSEPGNA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgtcaaaagggcattcgctacaagacccttacctgaataccctgcgtaaggaacgcgtc cctgtttccatctatctggtcaacggcatcaagctgcagggccagatcgagtccttcgac cagttcgtcatcctgctgaagaacaccgtcagccagatggtctacaagcacgccatttcc accgtcgtccccagccgtccggtgcgtttgccgagcgcaggtgatgccgagcagggcgat agcgaaccgggtaacgcctga

DBGET integrated database retrieval system