Pseudomonas xanthosomatis: KSS93_01030 Help Entry KSS93_01030       CDS       T07606                                  Name (GenBank) TIGR02449 family protein   KO K09892   cell division protein ZapB Organism pxa  Pseudomonas xanthosomatis Brite KEGG Orthology (KO) [BR:pxa00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pxa03036]     KSS93_01030 Chromosome and associated proteins [BR:pxa03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     KSS93_01030 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Filament ADIP Asd-4 ZapB Motif Other DBs NCBI-ProteinID:  QXH46534 LinkDB All DBs Position 235690..235899 Genome browser AA seq 69 aa AA seqDB search MQENDLQALMSRFELLIERVEQLKRQNALLVAQEKSWREERAHLIEKNEIAKRKIESMIL RLKALEQDS NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgcaagagaacgacctgcaagcgctgatgagccggttcgagttgctgatcgagcgcgtc gagcaactaaaacggcaaaacgcactcttagttgctcaggaaaaatcctggcgcgaggag cgcgcacacctcatcgaaaagaacgagatcgccaaacgcaagatcgaatcgatgatcttg cgcctcaaggccctggagcaagactcatga

DBGET integrated database retrieval system