KEGG   Pseudoalteromonas xiamenensis: J5O05_20815
Entry
J5O05_20815       CDS       T07215                                 
Name
(GenBank) hypothetical protein
  KO
K21785  4-hydroxy-2,2'-bipyrrole-5-methanol dehydrogenase
Organism
pxi  Pseudoalteromonas xiamenensis
Pathway
pxi00333  Prodigiosin biosynthesis
pxi01100  Metabolic pathways
pxi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pxi00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    J5O05_20815
SSDB
Motif
Pfam: Nitroreductase TM1586_NiRdase
Other DBs
NCBI-ProteinID: QTH73227
LinkDB
Position
unnamed5:689300..690307
AA seq 335 aa
MDGFYDALERAIETARLAPSSHNCQPWRVDYSLLSQEVSIGFDNHRVLRGLESLEREMFI
SAGVFTHFLTALLAYQGYQLNWQWQSEYGDHRVLATSGVTQLNSGSDAEEYQALSQRIRE
RHTIRSRFKTTAVDIHSLETIVQHASCHFYSADHVGTTLGNLTKQYAALDFTNKSAWEET
YNYIRFDEDEFAEDGFYLRNLFGPVSKPFRLLFRYGFHPTMMPINKRLGLAKKMAAGLGE
LVESGPYYLALSPKENSQEALFECGYELGALWLYMQRQGIGLHPISVLVQHETARKALAQ
SLQCPPPVFFARLGHIEQSGLDAPRRSVESILNCV
NT seq 1008 nt   +upstreamnt  +downstreamnt
atggatggattttacgacgcgctagagcgcgcaatcgaaacggcaaggcttgctccttct
tcacataactgccagccatggcgggtagattacagtttactgtcccaagaagtcagtatc
ggttttgataatcatcgagtgttacgcggactagaaagtttagagcgtgagatgtttatc
agtgccggcgtatttacccattttctcacggcgttgttggcataccaaggctatcaattg
aattggcaatggcaaagcgagtatggagatcatcgtgtgttagcgaccagtggcgttact
caattgaatagcggctctgatgcagaagaatatcaagctcttagtcagcgcatccgtgaa
cgccataccattcgcagtcggtttaagacaacagcagttgatattcattcgttggaaacg
atagttcagcacgcgtcttgccatttttattccgctgaccatgtggggaccaccttaggt
aatttaactaagcaatacgctgcattggattttactaataagtcggcatgggaagaaacg
tacaattacattcgcttcgatgaggatgaatttgctgaagatggattttacttacgtaat
ctatttggtccagttagtaagccgtttcgtctgttgtttcggtatgggtttcatccaaca
atgatgccaattaacaagcgtttagggcttgcaaaaaaaatggcggcaggacttggagaa
ctggttgaaagtggaccttattacctggcgttaagtccaaaagaaaactctcaagaagcc
ctatttgagtgcggttatgaattaggcgcactttggttgtatatgcaaaggcaagggatt
gggcttcatccaatcagtgttttggtacaacatgaaacagcgcgaaaagctttagcgcag
agtcttcaatgccctcctccagttttctttgctcgacttgggcacattgaacaaagcgga
ttggacgcaccaaggcgtagtgttgaaagcattttgaactgtgtttag

DBGET integrated database retrieval system