Papilio xuthus (Asian swallowtail): 106116974 Help Entry 106116974         CDS       T07456                                  Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A [EC:3.6.5.2] Organism pxu  Papilio xuthus (Asian swallowtail) Pathway pxu04137   Mitophagy - animal pxu04140   Autophagy - animal pxu04142   Lysosome biogenesis pxu04144   Endocytosis pxu04145   Phagosome pxu04148   Efferocytosis Brite KEGG Orthology (KO) [BR:pxu00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     106116974    04145 Phagosome     106116974    04142 Lysosome biogenesis     106116974    04140 Autophagy - animal     106116974    04137 Mitophagy - animal     106116974    04148 Efferocytosis     106116974  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pxu04131]     106116974   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pxu04147]     106116974    04031 GTP-binding proteins [BR:pxu04031]     106116974 Enzymes [BR:pxu01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.5  Acting on GTP to facilitate cellular and subcellular movement     3.6.5.2  small monomeric GTPase      106116974 Membrane trafficking [BR:pxu04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     106116974  Endosome - Golgi transport     106116974 Exosome [BR:pxu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    106116974   Exosomal proteins of other body fluids (saliva and urine)    106116974   Exosomal proteins of colorectal cancer cells    106116974   Exosomal proteins of bladder cancer cells    106116974 GTP-binding proteins [BR:pxu04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     106116974 SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 Gtr1_RagA GTP_EFTU RsgA_GTPase ATP_bind_1 nSTAND3 Septin AAA_16 cobW PduV-EutP AAA_22 NACHT AAA_7 ATPase_2 AAA_5 AAA_24 G-alpha NTPase_1 SRPRB NB-ARC AAA_14 ABC_tran TniB ATP-synt_ab RNA_helicase PRK Motif Other DBs NCBI-GeneID:  106116974 NCBI-ProteinID:  XP_013166492 UniProt:  A0A194PQ44 LinkDB All DBs Position Unknown AA seq 208 aa AA seqDB search MASRKKVLLKVIILGDSGVGKTSLMNQFVNKKFSNQYKATIGADFLTKEVIVDDRIVTMQ IWDTAGQERFQSLGMAFFRGADCCVLVFDVTAPNTFKSLESWRDEFLIQASPRDPDNFPF VILGNKVDLENRGVSAKRAQQWCQSKNDLPYFETSAKEAVNVELAFQTIARNALAQETEA ELYNEFPDQIKLNANDNARNRDGDNCAC NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atggcatcgagaaaaaaggttttattgaaggtcatcatccttggcgatagtggcgttggt aaaacttcgctcatgaatcagtttgtcaacaagaaattttccaatcagtacaaggcaaca ataggggcagattttcttacaaaagaggtaatcgtcgatgacagaattgtaacaatgcaa atttgggatacagctggacaagagcgtttccagtcgttggggatggccttctttcgcgga gcggattgttgcgttttagtgtttgacgtaacggcccccaataccttcaagtccttggaa agttggcgagatgaattcttgatacaggcctcaccccgtgatccagacaacttcccgttt gtcattttaggcaataaggtcgatttagaaaatcgtggagtatcagctaaacgtgcgcag cagtggtgtcagagcaaaaatgatctaccttacttcgaaaccagtgccaaagaagccgtg aatgtagaactagccttccagactattgctcgtaatgccttggctcaggaaactgaagca gagctgtacaatgagttcccagatcagatcaagctcaatgctaatgacaatgcacgcaac agagatggggataactgtgcctgctag

DBGET integrated database retrieval system